PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf07231g05006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 515aa    MW: 56187.3 Da    PI: 5.2076
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf07231g05006.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.66.6e-39163222261
                    zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                               ++k+l+cprC+s +tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+s
  Niben101Scf07231g05006.1 163 PDKILPCPRCNSIDTKFCYYNNYNVNQPRHFCKSCQRYWTAGGTMRNVPVGAGRRKNKNS 222
                               7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-30160220IPR003851Zinc finger, Dof-type
PfamPF027015.3E-32165221IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.817167221IPR003851Zinc finger, Dof-type
PROSITE patternPS013610169205IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    Send to blast
MRESKDPEIK LFGKKIALPE NEKVLPLTLS GEDSGYKNSG NASCGVKDSD TSVKDSETNT  60
GFDCDGCLED EKASSEEKDE EIDEENQEAE KNHISGELSK TKSEEKDQNQ MMEGSEDPKL  120
SSESDNNPKT PNIDEDSPAI KTSKTKNDPN DASNSQEKPL KKPDKILPCP RCNSIDTKFC  180
YYNNYNVNQP RHFCKSCQRY WTAGGTMRNV PVGAGRRKNK NSAPHCRHIT IPEALQAERI  240
DPPNGFHHPT FKPNGIVLSF GPDSPLSESM ASILSLSEKK VPNGIHNGFY GPENKNSFRE  300
GGENGDDCCG GSSVTTSTSM VDGGTHRHNE VVAPNVNGFA PPVPCMPGIP WPYPWNAAVP  360
LPAICPPGYP LPLCPPPYWN CNMLGPWSIP WLTPPLPNEN PKGSGSTPNS PLGKHSREGD  420
LLNSNSPDEK EPSEEKNSER SVLVPKTLRI DDPNEAAKSS IWSTLGIKYD SVSRGGLFKA  480
LQPKSDKKDD TATTSPILQA NPAALSRSLS FQERA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009587736.10.0PREDICTED: cyclic dof factor 3
TrEMBLM1BQ210.0M1BQ21_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000502730.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53224122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.11e-87cycling DOF factor 3